Weifang Ruze New Material Co., Ltd.

 

Your Aspiration is Our Commitment

Home
Products
About Us
Factory Tour
Quality Control
Contact Us
Request A Quote
Home ProductsPharmaceutical Intermediates

Pharmaceutical Peptides Bodybuilding Peptide CJC -1295 DAC Or Without Dac

Ruze supply good service, thanks.

—— Gaurav

I'm Online Chat Now

Pharmaceutical Peptides Bodybuilding Peptide CJC -1295 DAC Or Without Dac

China Pharmaceutical Peptides Bodybuilding Peptide CJC -1295 DAC Or Without Dac supplier

Large Image :  Pharmaceutical Peptides Bodybuilding Peptide CJC -1295 DAC Or Without Dac

Product Details:

Place of Origin: Weifang,China
Brand Name: RUZE
Certification: COA MSDS
Model Number: 863288-34-0

Payment & Shipping Terms:

Minimum Order Quantity: 1box
Price: USD 50/box
Packaging Details: 2mg/vial,10vial/box
Delivery Time: 5-7days
Payment Terms: L/C, T/T, Western Union, MoneyGram
Supply Ability: 10000box/month
Contact Now
Detailed Product Description
MF: C152H252N44O42 MW: 3367.89688
Impurity: ≤0.5% Heavy Metal: ≤20ppm
Color: White

Pharmaceutical Peptides Bodybuilding Peptide CJC -1295 DAC Or Without Dac

 

Product Name
CJC 1295 No DAC
Other Names
MPA-Lys30,D-Ala2,Gln8,Ala15,Leu27-GRF (1-29) amide
Purity
>99%
CAS No.
863288-34-0
Appearance
White powder
M.W.
3367.89
M.F.
C165H269N47O46
Shelf Life
2 Years

[Product Name]:CJC1295
[Synonyms]:CJC-1295WithoutDAC86328-34-0;CJC1295withoutDAC;CJC1295;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;L-Tyrosyl-D-alanyl-L-α-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-allothreonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl;CJC-1295(10mg);Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-TyChemicalbookrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide
[CAS]: 863288-34-0
[MF]: C152H252N44O42
[MW]: 3367.89688
[Purity]: 99%
[Appearance]: White Crystalline Powder

[Crizotinib COA]:

 

Appearance
White to off white powder
Consistent
Purity(HPLC)
≥95%
98.17%
Water
<6.0%
4.46%
Acetic Acid
3.0-8.0%
5.60%
Trifluoroacetic Acid
<0.25%
0.055%
Peptide
≥80%
84.60%
MS
Consistent
Consistent

Functions:

 

CJC-1295 is a long acting Growth Hormone Releasing Hormone, which causes the anterior pituitary to release more growth hormone. GHRH is released in pulses in the body, which alternate with corresponding pulses of somatostatin (growth-hormone inhibiting-hormone). Clinical Research was first conducted for CJC-1295 during the mid-2000s. The objective of the peptide was to treat visceral fat deposits in obese AIDS patients, as increased levels of exogenous hgH are presumed to increase lipolysis (fat loss). The clinical research was ultimately successful for most research subjects.

 

Applications:


CJC-1295 has shown some amazing results as a growth hormone releasing hormone (GHRH) analog. Not only has CJC-1295 shown the ability to increase growth hormone and IGF-I secretion and its benefits, but it has been able to do so in very large amounts. Recent research studies have shown that CJC - 1295 stimulates GH and IGF-1 Secretion, and will keep a steady increase of HGH and IGF-1 with no increase in prolactin, leading to intense fat loss, and increases protein synthesis.

 

 

 
RELATED PRODUCTS

 

Product Name Package in per vial,10vials per box
HGH 10iu
GHRP-2 5mg
GHRP-6 5mg
CJC-1295 WITHOUT DAC 2mg
CJC-1295 DAC 2mg
Melanotan-2 10mg
Melanotan-1 10mg
HGH Fragment 176-191(Not oxidation) 2mg
HGH Fragment 176-191(Not oxidation) 5mg
HGH Fragment 176-191(oxidation) 2mg
HGH Fragment 176-191(oxidation) 5mg
Ipamorelin 2mg
Hexarelin 140703-51-1 2mg
Gonadorelin 33515-09-2 2mg
Sermorelin 86168-78-7 2mg
Thymosin beta4(tb500) 2mg
Thymosin beta4(tb500) 5mg
Thymosin beta4(tb500) 10mg
PT141 10mg
PEG-MGF 2mg
MGF 2mg
Selank 5mg
DSIP 2mg
BPC-157 5mg
IGF-1 DES 1mg
Triptorelin 2mg
Tesamorelin 2mg
Oxytocin 2mg
AOD9604 2mg
Adipotide 2mg
Aicar 50mg
HGH 10iu
IGF LR3 1mg
FST follistatin 344 1mg
ACE-031 1mg
GDF-8 1mg
HCG 5000iu

 

 

Pharmaceutical Peptides Bodybuilding Peptide CJC -1295 DAC Or Without DacPharmaceutical Peptides Bodybuilding Peptide CJC -1295 DAC Or Without Dac

Pharmaceutical Peptides Bodybuilding Peptide CJC -1295 DAC Or Without Dac

Pharmaceutical Peptides Bodybuilding Peptide CJC -1295 DAC Or Without Dac

Pharmaceutical Peptides Bodybuilding Peptide CJC -1295 DAC Or Without DacPharmaceutical Peptides Bodybuilding Peptide CJC -1295 DAC Or Without Dac

Weifang Ruze New Material Co.,LTD supply free sample and datebase on CJC-1295n (CAS No.: 863288-34-0), if you want futher information about CJC-1295 (CAS No.: 863288-34-0), please feel free to contract us.

Contact Details
Weifang Ruze New Material Co., Ltd.

Contact Person: Ma

Tel: 86-13583611556

Send your inquiry directly to us (0 / 3000)